PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj1g3v0130130.1
Common NameMYB103
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family MYB
Protein Properties Length: 265aa    MW: 30379 Da    PI: 6.5101
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj1g3v0130130.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.51.6e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd+ lvd+++++G g+W++ ++  g++R++k+c++rw +yl
  Lj1g3v0130130.1 14 KGPWSQEEDKVLVDYIQKHGHGSWRALPQLAGLNRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding54.42.9e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++ eE++l++++++ lG++ W+tIa++++ gRt++++k+ w+++l
  Lj1g3v0130130.1  67 RGKFSDEEEQLIINLHASLGNK-WATIASHLP-GRTDNEIKNLWNTHL 112
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.769961IPR017930Myb domain
SuperFamilySSF466892.23E-3111108IPR009057Homeodomain-like
SMARTSM007174.2E-141363IPR001005SANT/Myb domain
PfamPF002499.9E-171461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-241568IPR009057Homeodomain-like
CDDcd001672.13E-101661No hitNo description
PROSITE profilePS5129426.88762116IPR017930Myb domain
SMARTSM007174.3E-1566114IPR001005SANT/Myb domain
PfamPF002491.1E-1567112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-2769116IPR009057Homeodomain-like
CDDcd001676.13E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 265 aa     Download sequence    Send to blast
MMRTPSIDES GMKKGPWSQE EDKVLVDYIQ KHGHGSWRAL PQLAGLNRCG KSCRLRWTNY  60
LRPDIKRGKF SDEEEQLIIN LHASLGNKWA TIASHLPGRT DNEIKNLWNT HLKKKLLQMG  120
LDPVTHYATN RAKLHLLQNM LQNNNFQNIY NGSVAFPSLH QIQPSFQNFE APQHLSGGRD  180
DISNYRECLK FDEQLGLSNI ADPTPSNSLP KLVSASPECS PVNQEENMAN HKEWSNFDPS  240
STAFETWGEF MSEDTSETYW KDFME
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-281211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB1086500.0AB108650.1 Lotus japonicus MYB103 gene for transcription factor MYB103, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007131513.11e-111hypothetical protein PHAVU_011G019200g
TrEMBLQ84PP30.0Q84PP3_LOTJA; Transcription factor MYB103
STRINGGLYMA01G44370.21e-108(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40234172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02940.12e-74myb domain protein 107